Everything below concerns ICP-MS. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Last reviewed on 2025-12-02. Where a claim depends on a specific study, the study is described rather than over-claimed.
Several names circulate for the same material, which complicates literature searches. Cosmetic ingredient lists often use copper tripeptide-1, while older biochemistry papers use glycyl-L-histidyl-lysine or its abbreviation GHK. The copper complex is sometimes written as GHK-Cu(II) to make the oxidation state explicit. Terminology is not fully standardized, so matching a compound across sources requires attention to the exact sequence, the counterion, and the stated copper content. Reviews that compare studies must account for these naming differences before drawing conclusions.
GHK-Cu is the copper(II) complex of the tripeptide glycyl-L-histidyl-L-lysine, a short sequence of three amino acids. The peptide was first isolated from human plasma in 1973 during research on factors that influence tissue repair in liver. Its ability to bind copper ions became a central point of interest because the metal changes the peptide's chemistry and its behaviour in laboratory systems. Today the compound appears in cosmetic formulations, cell-culture studies, and biochemistry literature under several names.
Commercial products list GHK-Cu as copper tripeptide-1, a cosmetic ingredient. Formulators value its blue color and water solubility, which allow incorporation into serums, creams, and masks. Regulatory treatment varies: in the United States it appears in cosmetics, while some jurisdictions classify certain claims as drug-like. The compound is not an approved drug for any indication. Studies continue to examine its effects on skin, hair, and wound repair, but dosage, delivery, and long-term safety questions remain open.
GHK-Cu is a coordination complex formed between the tripeptide glycyl-L-histidyl-L-lysine and copper(II). The peptide sequence consists of glycine, histidine, and lysine, and its imidazole and amino groups provide binding sites for the metal ion. In the complex, copper is held through nitrogen donors from the histidine side chain, the N-terminal amine, and deprotonated amide nitrogens. The resulting compound is intensely blue and water-soluble. It occurs naturally in human plasma, saliva, and urine at low concentrations.
The peptide was first isolated from human albumin in 1973 by Loren Pickart, who later described its copper-binding behavior. Early work linked the complex to wound healing and tissue remodeling. Plasma levels of GHK decline with age, a pattern that stimulated interest in topical and supplemental applications. Researchers have reported that the tripeptide influences collagen synthesis, antioxidant defense, and inflammatory signaling in cell and animal models. Human clinical evidence remains limited and often relies on small studies.
| Property | Value | Notes |
|---|---|---|
| Peptide sequence | Gly-His-Lys | Three amino acids, histidine in the middle |
| Complex formula | C14H22CuN6O4 | One copper(II) ion per peptide |
| Molar mass (complex) | approx. 402.9 g/mol | Depends on counterion and hydration state |
| Appearance | Blue to blue-violet solid | Colour arises from copper coordination |
| Common synonyms | Copper tripeptide-1, GHK-Cu | Naming varies between disciplines |
The sequence now called GHK was first reported in the early 1970s after isolation from human plasma, where it was noted to influence liver cell behavior in laboratory preparations. Later work described a copper-binding form and its activity in fibroblast and wound-model experiments. Review articles frequently group the substance with other copper peptides. Concentrations in blood appear to fall with age in several small surveys, although the reason for this trend is not settled. Whether such a decline carries functional consequences remains an open question.
Published work on GHK-Cu concentrates largely on cell culture systems rather than whole organisms. Frequently used endpoints include collagen synthesis, expression of matrix metalloproteinases, and migration of fibroblasts. Some reports describe antioxidant behavior, while others stress delivery of copper into cells. These mechanisms are proposed rather than demonstrated, and the relative weight of each pathway is unclear. Human trials are few and generally small, so laboratory findings should not be read as confirmed clinical results.
GHK-Cu is a coordination complex formed between the tripeptide glycyl-L-histidyl-L-lysine and a copper(II) ion. The peptide backbone consists of glycine, histidine, and lysine joined in that order. Copper is held through the imidazole nitrogen of histidine and the alpha-amino group at the N-terminus, which together produce a square-planar arrangement around the metal center. The solid appears blue to violet, a color that originates from d-d electronic transitions within the copper coordination sphere. The complex is indexed under CAS number 89030-95-5.
The compound was first isolated from human plasma in the 1970s by Loren Pickart, who later described copper-binding activity in liver and other tissues. Early reports focused on its presence in blood and its ability to carry copper between proteins. Commercial and cosmetic use of the term 'copper peptide' has since broadened, and labels rarely distinguish GHK-Cu from other copper-binding fragments. This naming overlap makes literature searching harder, because cosmetic ingredient lists, supplier catalogues and laboratory papers use different vocabularies for the same molecule.
GHK-Cu is the copper-binding complex formed by the tripeptide glycyl-L-histidyl-L-lysine and a copper(II) ion. The free peptide is usually written as GHK, and the complex is written as GHK-Cu or Cu-GHK. The sequence was identified in human plasma and later detected in saliva and urine. Its name comes from the single-letter codes of glycine, histidine and lysine. The complex is widely described as a naturally occurring carrier of copper in blood rather than as a free peptide with its own hormonal role.
Stability of GHK-Cu in solution depends on pH, temperature, buffer composition, and oxygen exposure. The copper center can undergo reduction or dissociation, especially in the presence of strong metal chelators such as EDTA. Aqueous solutions are often prepared fresh or stored frozen to limit degradation. Lyophilized solid is more stable than liquid formulations, but it can absorb moisture and should be kept dry. Light exposure may also affect copper complexes, though the effect is often modest.
Purity assessment typically involves high-performance liquid chromatography for the peptide and atomic spectroscopy for copper content. The ratio of copper to peptide is a key quality parameter; a value near one indicates proper stoichiometry. Impurities can include free peptide, copper salts, and truncated sequences from synthesis. Because the complex is dynamic, sample preparation and mobile-phase conditions can shift the observed species. Reported purity values therefore depend on the analytical method and should be interpreted with that context.
Many RNAs are involved in modifying other RNAs. Introns are spliced out of pre-mRNA by spliceosomes, which contain several small nuclear RNAs (snRNA), or the introns can be ribozymes that are spliced by themselves. RNA can also be altered by having its nucleotides modified to nucleotides other than A, C, G and U. In eukaryotes, modifications of RNA nucleotides are in general directed by small nucleolar RNAs (snoRNA; 60–300 nt), found in the nucleolus and cajal bodies. snoRNAs associate with enzymes and guide them to a spot on an RNA by basepairing to that RNA. These enzymes then perform the nucleotide modification. rRNAs and tRNAs are extensively modified, but snRNAs and mRNAs can also be the target of base modification. RNA can also be methylated.
Latent antithrombin on formation immediately links to a molecule of native antithrombin to form the heterodimer, and it is not until the concentration of latent antithrombin exceeds 50% of the total antithrombin that it can be detected analytically. Not only is the latent form of antithrombin inactive against its target coagulation proteases, but its dimerisation with an otherwise active native antithrombin molecule also results in the native molecules inactivation. The physiological impact of the loss of antithrombin activity either through latent antithrombin formation or through subsequent dimer formation is exacerbated by the preference for dimerisation to occur between heparin activated β-antithrombin and latent antithrombin as opposed to α-antithrombin. A form of antithrombin that is an intermediate in the conversion between native and latent forms of antithrombin has also been isolated and this has been termed prelatent antithrombin.
== Legacy == The popular image of the sans-culotte has gained currency as an enduring symbol for the passion, idealism and patriotism of the common man of the French Revolution. The term sans-culottism, sans-culottisme in French, refers to this idealized image and the themes associated with it. Many public figures and revolutionaries who were not strictly working class styled themselves citoyens sans-culottes in solidarity and recognition. However, in the period immediately following the Thermidorian Reaction, the sans-culottes and other far-left political factions were heavily persecuted and repressed by the likes of the Muscadins. The French Republican Calendar at first termed the complementary days at the end of the year Sansculottides; however, the National Convention suppressed the name when adopting the Constitution of the Year III (1795) and substituted the name jours complémentaires ("additional days").
=== Weight loss and regain === As of 2007, there was no evidence showing that weight loss is directly correlated with ingesting capsaicin. Well-designed clinical research had not been performed because the pungency of capsaicin in prescribed doses under research prevented subjects from complying in the study. A 2014 meta-analysis of further trials found weak evidence that consuming capsaicin before a meal might slightly reduce the amount of food consumed, and might drive food preference toward carbohydrates.
Catatonia is a neuropsychiatric syndrome most commonly seen in people with underlying mood disorders such as major depressive disorder, or psychotic disorders such as schizophrenia. People with catatonia exhibit abnormal movement and behaviors that vary from person to person, and which may fluctuate in intensity within a single episode. People with catatonia appear withdrawn, with limited interaction with the outside world and difficulty processing information. They may be nearly motionless for days on end or perform repetitive, purposeless movements. People may exhibit very different sets of behaviors and still be diagnosed with catatonia. Treatment with benzodiazepines or electroconvulsive therapy is most effective and leads to remission of symptoms in most cases. There are different subtypes of catatonia, which represent groups of symptoms that commonly occur together. These include stuporous/akinetic catatonia, excited catatonia, malignant catatonia, and periodic catatonia. Catatonia has historically been related to schizophrenia, but is most often seen in mood disorders. It is now known that catatonic symptoms are nonspecific and may occur in other mental, neurological, and medical conditions. The prognosis of catatonia is typically good, with complete remission in some patients; however, outcomes vary depending on the underlying disorder.
Sources: en.wikipedia.org
The state department of health reviewed the test results and determined that the amounts found were well below recommended public health screening levels. In 2013, BASF reported a spill of several hundred kilogrammes of the chelating agent Trilon-B (tetrasodium EDTA) into the river Rhine from BASF's headquarters in Ludwigshafen, Germany. BASF has instituted an eco-efficiency analysis to promote green engineering principles.
Complex nests are built by many ant species, but other species are nomadic and do not build permanent structures. Ants may form subterranean nests or build them on trees. These nests may be found in the ground, under stones or logs, inside logs, hollow stems, or even acorns. The materials used for construction include soil and plant matter, and ants carefully select their nest sites; Temnothorax albipennis will avoid sites with dead ants, as these may indicate the presence of pests or disease. They are quick to abandon established nests at the first sign of threats. The army ants of South America, such as the Eciton burchellii species, and the driver ants of Africa do not build permanent nests, but instead, alternate between nomadism and stages where the workers form a temporary nest (bivouac) from their own bodies, by holding each other together. Weaver ant (Oecophylla spp.) workers build nests in trees by attaching leaves together, first pulling them together with bridges of workers and then inducing their larvae to produce silk as they are moved along the leaf edges. Similar forms of nest construction are seen in some species of Polyrhachis.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
The IDF traces its roots to Jewish paramilitary organizations in the New Yishuv, starting with the Second Aliyah (1904 to 1914). The first such organization was Bar-Giora, founded in September 1907. Bar-Giora was transformed into Hashomer in April 1909, which operated until the British Mandate of Palestine came into being in 1920. Hashomer was an elitist organization with narrow scope, and was mainly created to protect against criminal gangs seeking to steal property. The Zion Mule Corps and the Jewish Legion, both part of the British Army of World War I, further bolstered the Yishuv with military experience and manpower, forming the basis for later paramilitary forces. After the 1920 Palestine riots against Jews in April 1920, the Yishuv leadership realised the need for a nationwide underground defense organization, and the Haganah was founded in June of the same year. The Haganah became a full-scale defense force after the 1936–1939 Arab revolt in Palestine with an organized structure, consisting of three main units—the Field Corps, Guard Corps, and the Palmach. During World War II, many Jews from the Yishuv enlisted in the British Armed Forces. Many of them served in the British Army, culminating in the formation of the Jewish Brigade. These would eventually form the backbone of the Israel Defense Forces, and provide it with its initial manpower and doctrine. Following Israel's Declaration of Independence, prime minister and defense minister David Ben-Gurion issued an order for the formation of the Israel Defense Forces on 26 May 1948.
Sources: en.wikipedia.org
=== Generic names === Protriptyline is the English and French generic name of the drug and its INNTooltip International Nonproprietary Name, BANTooltip British Approved Name, and DCFTooltip Dénomination Commune Française, while protriptyline hydrochloride is its USANTooltip United States Adopted Name, USPTooltip United States Pharmacopeia, and BANMTooltip British Approved Name. Its generic name in Spanish and Italian and its DCITTooltip Denominazione Comune Italiana are protriptylina, in German is protriptylin, and in Latin is protriptylinum.
Many different inventions and ideas which may or may not have been practical about auto safety have been put forward but never made it to a production car. Such items include the driver seat in the middle (to give the person a better view) (the exception being the McLaren F1 super car) and control stick steering. Automotive safety may have become an issue almost from the beginning of mechanised road vehicle development. The second steam-powered "Fardier" (artillery tractor), created by Nicolas-Joseph Cugnot in 1771, is reported by some to have crashed into a wall during its demonstration run. However, according to Georges Ageon, the earliest mention of this occurrence dates from 1801 and it does not feature in contemporary accounts. One of the earliest recorded car-related fatalities was Mary Ward, on August 31, 1869, in Parsonstown, Ireland. In 1922, the Duesenburg Model A became the first car to have four-wheel hydraulic brakes.
ThO2 + 2 Ca → 2 CaO + Th Sometimes thorium is extracted by electrolysis of a fluoride in a mixture of sodium and potassium chloride at 700–800 °C in a graphite crucible. Highly pure thorium can be extracted from its iodide with the crystal bar process. Uranium is extracted from its ores in various ways. In one method, the ore is burned and then reacted with nitric acid to convert uranium into a dissolved state. Treating the solution with a solution of tributyl phosphate (TBP) in kerosene transforms uranium into an organic form UO2(NO3)2(TBP)2. The insoluble impurities are filtered and the uranium is extracted by reaction with hydroxides as (NH4)2U2O7 or with hydrogen peroxide as UO4·2H2O. When the uranium ore is rich in such minerals as dolomite, magnesite, etc., those minerals consume much acid. In this case, the carbonate method is used for uranium extraction. Its main component is an aqueous solution of sodium carbonate, which converts uranium into a complex [UO2(CO3)3]4−, which is stable in aqueous solutions at low concentrations of hydroxide ions. The advantages of the sodium carbonate method are that the chemicals have low corrosivity (compared to nitrates) and that most non-uranium metals precipitate from the solution. The disadvantage is that tetravalent uranium compounds precipitate as well. Therefore, the uranium ore is treated with sodium carbonate at elevated temperature and under oxygen pressure:
Empagliflozin/linagliptin/metformin, sold under the brand name Trijardy XR, is a fixed-dose combination medication used for the treatment of type 2 diabetes. It is a combination of empagliflozin, linagliptin, and metformin. Empagliflozin/linagliptin/metformin was approved for use in the United States in January 2020.
== External links == Kavkaz-2008 leaflet ("Soldier, know your probable enemy"), The Guns of August 2008: Russia's War in Georgia, p. xi - xii Anna Nemtsova, Q&A: Georgia's Mikheil Saakashvili on Russia Fight, Newsweek, 11 August 2008 William Rees-Mogg, Georgia: another Sarajevo moment avoided, The Times, 11 August 2008 Illarionov: Russia Lost the Georgian War, The Other Russia, 13 August 2008 (in Russian) "We Will never surrender", Der Spiegel, 18 August 2008 (in Russian) Vadim Rechakolv's comment on the movement of Russian tank column through the Roki Tunnel on 7 August Denis Macshane, Denis MacShane Explores the Myths About Russia, Newsweek, 5 September 2008 Ministry of Foreign Affairs of Georgia, Media and telephone intercepts confirm Russia started the war, 20 September 2008 (in Russian) André Glucksmann, Putin's doctrine, 22 October 2008 The Government of Georgia, Factual Evidence Contradicts War Claims in Recent Media Stories;, 18 November 2008 Bear on the Prowl? The Return of Russia as a Great Power Archived 17 March 2024 at the Wayback Machine; Australian Institute of International Affairs, November 2008 Julia Latynina - Articles on August war (Translations) Report by the Government of Georgia on the aggression by the Russian Federation against Georgia, 7 August 2009. PDF file. (in Russian) Grani TV, Andrei Nekrasov, Movie director, Garry Kasparov about "Russian Lessons", 14 September 2009 Caucasus Analytical Digest No.
Sources: en.wikipedia.org
The peptide is glycyl-L-histidyl-L-lysine, a three-amino-acid sequence commonly abbreviated GHK. It binds a single copper(II) ion under typical laboratory conditions. The free peptide and the copper complex are separate chemical species with different properties.
The sequence was identified in human plasma in 1973. Early work examined its presence in blood and its proposed role in tissue repair. The copper-binding property was characterized afterward and became the focus of much later research.
The tripeptide has been measured in human plasma and other biological fluids. Whether it circulates mainly as the copper complex or as the free peptide remains an open question. Natural concentrations are low and difficult to measure reliably.
GHK is the free tripeptide, while GHK-Cu includes a bound copper(II) ion. The copper complex is the form most often studied for skin and wound-related activity. The two names are sometimes used interchangeably in product labeling, but they refer to distinct chemical species.